DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14095 and CG13068

DIOPT Version :9

Sequence 1:NP_649112.1 Gene:CG14095 / 40112 FlyBaseID:FBgn0036870 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_648856.1 Gene:CG13068 / 39784 FlyBaseID:FBgn0036588 Length:109 Species:Drosophila melanogaster


Alignment Length:142 Identity:62/142 - (43%)
Similarity:77/142 - (54%) Gaps:44/142 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYA--VVICALIACVAAKPGLLHTPLAALPAPVI-AAPAPVVTAASSQVVARTFNGIAAAPVI 62
            |||.:  ||:|||:||.:|:|    .|.....|||: ||||.||||.|||.|||.|||:||||| 
  Fly     1 MFKLSALVVLCALVACSSAEP----KPAILAAAPVVAAAPAGVVTATSSQYVARNFNGVAAAPV- 60

  Fly    63 AQVPVAPAPVLRTVAAPLAAPLAAPLAAPLRAPAPVAFAAPVAAPLAAPILNRVAPFAAPIATPF 127
                         |||...||:||           .|:.|||||          |.:.||:|..:
  Fly    61 -------------VAAAYTAPVAA-----------AAYTAPVAA----------AAYTAPVAAAY 91

  Fly   128 AA-PY-AHPYAA 137
            :| || |:||:|
  Fly    92 SAYPYAAYPYSA 103



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.