Sequence 1: | NP_649112.1 | Gene: | CG14095 / 40112 | FlyBaseID: | FBgn0036870 | Length: | 162 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648856.1 | Gene: | CG13068 / 39784 | FlyBaseID: | FBgn0036588 | Length: | 109 | Species: | Drosophila melanogaster |
Alignment Length: | 142 | Identity: | 62/142 - (43%) |
---|---|---|---|
Similarity: | 77/142 - (54%) | Gaps: | 44/142 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKYA--VVICALIACVAAKPGLLHTPLAALPAPVI-AAPAPVVTAASSQVVARTFNGIAAAPVI 62
Fly 63 AQVPVAPAPVLRTVAAPLAAPLAAPLAAPLRAPAPVAFAAPVAAPLAAPILNRVAPFAAPIATPF 127
Fly 128 AA-PY-AHPYAA 137 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2BWJG | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005927 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR35685 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |