DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14095 and CG32214

DIOPT Version :9

Sequence 1:NP_649112.1 Gene:CG14095 / 40112 FlyBaseID:FBgn0036870 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001262045.1 Gene:CG32214 / 317919 FlyBaseID:FBgn0052214 Length:116 Species:Drosophila melanogaster


Alignment Length:165 Identity:79/165 - (47%)
Similarity:91/165 - (55%) Gaps:63/165 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYAVVICALIACVAAKPGLLHTPLA-------ALPAPVIAAPAPVVTAASSQVVARTFNGIAA 58
            |||||||:.||:||.|||||||..|||       :.||.|:|||||||||.||||:||.:|||||
  Fly     1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIAA 65

  Fly    59 APVIAQVPVAPAPVLRTVAAPLAAPLAAPLAAPLRAPAPVAFAAPVAAPLAAPILNRVAPFAAPI 123
            ||||                                       ||||||||||:   ||.:|   
  Fly    66 APVI---------------------------------------APVAAPLAAPV---VAKYA--- 85

  Fly   124 ATPFAAPYAHPYAAPVLAKYAAPLAYAPAPLNYAA 158
            |||.|||.|          |::||||: |||:|||
  Fly    86 ATPLAAPLA----------YSSPLAYS-APLSYAA 109



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448865
Domainoid 1 1.000 79 1.000 Domainoid score I15489
eggNOG 1 0.900 - - E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I7469
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.