DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Chd3 and PHF21A

DIOPT Version :9

Sequence 1:	NP_649111.1	Gene:	Chd3 / 40111	FlyBaseID:	FBgn0023395	Length:	892	Species:	Drosophila melanogaster
Sequence 2:	XP_011518459.1	Gene:	PHF21A / 51317	HGNCID:	24156	Length:	688	Species:	Homo sapiens

Alignment Length:	154	Identity:	46/154 - (29%)
Similarity:	64/154 - (41%)	Gaps:	48/154 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 KRGADPDWK----------TPGKASKDKRPKTNAKKQKFR--------------------DEEYC 38
            |||..|.:.          |..::|....|:....:..|.                    .|::|
Human   435 KRGRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTDGDIHEDFC 499

  Fly    39 KVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRC----------IPLPGKAEKILSWR 93
            .||...|.||.||:|..|||..||.||||:||||.||||||          ||.||....:.|:
Human   500 SVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSY- 563

  Fly    94 WALDRSVELRTSKGEKRREYFIKW 117
                  :..:.:| |:.::..:||
Human   564 ------IAYKAAK-EEEKQKLLKW 580

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Chd3	NP_649111.1	PHD2_CHD_II	37..79	CDD:277007	26/41 (63%)
		CHROMO	85..147	CDD:237991	5/33 (15%)
		CHROMO	181..233	CDD:214605
		SNF2_N	270..561	CDD:278600
		DEXDc	288..440	CDD:238005
		Helicase_C	585..700	CDD:278689
PHF21A	XP_011518459.1	ING	<382..544	CDD:331088	37/108 (34%)
PHF21A	XP_011518459.1	PHD_PHF21A	498..540	CDD:276998	26/41 (63%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0383
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900