DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd3 and CG7376

DIOPT Version :9

Sequence 1:NP_649111.1 Gene:Chd3 / 40111 FlyBaseID:FBgn0023395 Length:892 Species:Drosophila melanogaster
Sequence 2:NP_001261471.1 Gene:CG7376 / 38715 FlyBaseID:FBgn0035689 Length:1270 Species:Drosophila melanogaster


Alignment Length:383 Identity:93/383 - (24%)
Similarity:154/383 - (40%) Gaps:78/383 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 EISFEEVTTKTMRENQ--------TQYKFNVMLTSYEFISVDAAFLGCIDWAALVVDEAHRLRSN 417
            ||||.:.....:|..|        .|.|..::....:.:.....:...:::.....||..     
  Fly   913 EISFIKSIFAFLRSKQDFSEWKEECQSKLELLSCLQDLVKFQIKYWIEVEYMVKAFDELE----- 972

  Fly   418 QSKFFRILSKYRIGYKLLLTGTP-LQNNLE----ELFHLLNFLSSGKFNDLQTFQAEFTDV-SKE 476
                   :.|.||    |||..| .|:|..    :|...|.|   .::| |||.|..||.: .:.
  Fly   973 -------MCKMRI----LLTDDPEEQSNYRILACQLDEQLQF---NQYN-LQTSQLNFTRLCGRL 1022

  Fly   477 EQVKRLHE--ILEPHMLRRLKADVLKSMPPKSEFIVRVELSSMQKKFYKHILTKNFKALNQKGGG 539
            :.:|.|.|  ..:|..:.:.:.||...|.....|:.:..|.||::|             |.:.|.
  Fly  1023 KYLKHLKEDSADKPCPICQTQDDVRYVMMVCGHFVCQHCLDSMRRK-------------NGRAGV 1074

  Fly   540 RVCSLLNIMMDLRKCC--NHPYLFPSAAEEATISPSGLYEMSSLTKASGKLDLLSKMLKQLKADN 602
            ..|.|          |  :.|.|:.|....|..|..|.:.    ||.|..::|:.|    :|.:|
  Fly  1075 TKCPL----------CRQDSPQLYYSVRPGAHKSIIGDFS----TKISSVVELVLK----IKGEN 1121

  Fly   603 --HRVLLFSQMTKMLNVLEHFLEGEGYQYDRIDGSIKGDLRQKAIDRFNDPVSEHFVFLLSTRAG 665
              .::::|||...:|..:...|...|.|:       :.....|..|.|.:|:|.....|:....|
  Fly  1122 EQEKIIVFSQWQAILIEIARALSLNGIQF-------RNKCTNKDFDDFKNPLSNVTCLLMPLSKG 1179

  Fly   666 GLGINLATADTVIIFDSDWNPHNDVQAFSRAHRMGQKKKVMIYRFVTHNSVEERIMQV 723
            ..|:||..|..|.:.:...||.::.||..|.||.|||:...::||:.:.::||.|:.:
  Fly  1180 SKGLNLIEATHVFLVEPILNPGDERQAIGRIHRFGQKRPTKVHRFIVNETIEENILSL 1237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd3NP_649111.1 PHD2_CHD_II 37..79 CDD:277007
CHROMO 85..147 CDD:237991
CHROMO 181..233 CDD:214605
SNF2_N 270..561 CDD:278600 47/217 (22%)
DEXDc 288..440 CDD:238005 16/86 (19%)
Helicase_C 585..700 CDD:278689 31/116 (27%)
CG7376NP_001261471.1 SNF2_N 221..601 CDD:278600
PHD_SF 281..320 CDD:304600
TPR 636..669 CDD:197478
RING 1037..1083 CDD:238093 13/68 (19%)
HepA <1096..1238 CDD:223627 43/157 (27%)
Helicase_C 1108..1214 CDD:278689 31/116 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.