DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd3 and tou

DIOPT Version :9

Sequence 1:NP_649111.1 Gene:Chd3 / 40111 FlyBaseID:FBgn0023395 Length:892 Species:Drosophila melanogaster
Sequence 2:NP_001097270.1 Gene:tou / 36241 FlyBaseID:FBgn0033636 Length:3131 Species:Drosophila melanogaster


Alignment Length:237 Identity:66/237 - (27%)
Similarity:81/237 - (34%) Gaps:83/237 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DPDW---KTPGKASKDKRPKTNAKKQKFRDEEYCKVC-----SDGGDLLCCDSCPSVYHRTCLSP 64
            |.||   :...||       ||.:|        |.||     |..|.::.||.||..||..|..|
  Fly  2677 DGDWYCYECVNKA-------TNERK--------CIVCGGHRPSPVGKMIYCDLCPRAYHADCYIP 2726

  Fly    65 PLKSIPKGDWICPRCI---PLP---------GKAEKILSWRWALDRSVELRTSKGE-KRREYFIK 116
            ||..:|:|.|.|..||   |.|         |.:.|  |.|   ||.   |.|.|. |||....|
  Fly  2727 PLLKVPRGKWYCHGCISRAPPPKKRSAGGTSGSSSK--SRR---DRD---RESGGSAKRRSDNSK 2783

  Fly   117 WHGMSYWHCEWIP--EGQMLLHHASMVASFQRRSDMEEPSL--------------EELDDQ---- 161
            ...|.:...:.:|  .|....||.....|.....|....||              ...|||    
  Fly  2784 TPAMEHMQQQQMPLAGGDSHHHHHQQPPSLNSSHDESMNSLPAAPLSPAHSVVSATNYDDQHHAN 2848

  Fly   162 ---DGNLHERFYRYGIKPEWLLVQRVINHSEEPNGGTMYLVK 200
               ||:  .||:.:.|.|.              |.||..|::
  Fly  2849 NSVDGS--SRFHAHLIPPS--------------NNGTAALLE 2874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd3NP_649111.1 PHD2_CHD_II 37..79 CDD:277007 19/46 (41%)
CHROMO 85..147 CDD:237991 18/64 (28%)
CHROMO 181..233 CDD:214605 4/20 (20%)
SNF2_N 270..561 CDD:278600
DEXDc 288..440 CDD:238005
Helicase_C 585..700 CDD:278689
touNP_001097270.1 HAT_MBD 953..1027 CDD:238691
ZapA 1021..1127 CDD:294720
MAP7 1043..1198 CDD:283355
RILP-like 1085..>1179 CDD:304877
DDT 1255..1317 CDD:280886
WHIM1 1406..1455 CDD:292246
WHIM3 2190..2224 CDD:292248
PHD_BAZ2A_like 2640..2685 CDD:277020 3/7 (43%)
RanBP2-type Zn finger 2640..2659 CDD:275375
RanBP2-type Zn finger 2680..2698 CDD:275376 7/32 (22%)
PHD 2695..2744 CDD:279022 21/48 (44%)
Bromo_BAZ2A_B_like 3027..3123 CDD:99935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0383
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.