DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Chd3 and AIRE

DIOPT Version :9

Sequence 1:	NP_649111.1	Gene:	Chd3 / 40111	FlyBaseID:	FBgn0023395	Length:	892	Species:	Drosophila melanogaster
Sequence 2:	NP_000374.1	Gene:	AIRE / 326	HGNCID:	360	Length:	545	Species:	Homo sapiens

Alignment Length:	48	Identity:	26/48 - (54%)
Similarity:	34/48 - (70%)	Gaps:	0/48 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 RDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRCI 80
            ::|:.|.||.|||:|:|||.||..:|..||||||:.||.|.|.|..|:
Human   294 KNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCL 341

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Chd3	NP_649111.1	PHD2_CHD_II	37..79	CDD:277007	24/41 (59%)
		CHROMO	85..147	CDD:237991
		CHROMO	181..233	CDD:214605
		SNF2_N	270..561	CDD:278600
		DEXDc	288..440	CDD:238005
		Helicase_C	585..700	CDD:278689
AIRE	NP_000374.1	LXXLL motif 1	7..11
		Sp100	16..102	CDD:281203
		LXXLL motif 2	63..67
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	101..178
		SAND	197..>250	CDD:295351
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	234..290
		Interaction with histone H3 not methylated at 'Lys-4'	295..298		1/2 (50%)
		PHD1_AIRE	298..340	CDD:277014	24/41 (59%)
		Interaction with histone H3 not methylated at 'Lys-4'	304..312		5/7 (71%)
		Interaction with histone H3 not methylated at 'Lys-4'	331..335		2/3 (67%)
		Herpes_IE68	<332..375	CDD:280616	4/10 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	348..382
		LXXLL motif 3	414..418
		PHD2_AIRE	433..475	CDD:277015
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	489..508
		LXXLL motif 4	516..520
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0383
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900