powered by:
Protein Alignment Chd3 and Aire
DIOPT Version :9
Sequence 1: | NP_649111.1 |
Gene: | Chd3 / 40111 |
FlyBaseID: | FBgn0023395 |
Length: | 892 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006256309.1 |
Gene: | Aire / 294328 |
RGDID: | 1311139 |
Length: | 551 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 32/69 - (46%) |
Similarity: | 43/69 - (62%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 PKTNAKKQKFRDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRCIPLPGKAE 87
|..|..:...::|:.|.||.|||:|:|||.||..:|..||||||:.||.|.|.|..| |.|:.:
Rat 286 PLPNEPQVHQKNEDECAVCHDGGELICCDGCPRAFHLACLSPPLQEIPSGLWRCSCC--LQGRIQ 348
Fly 88 KILS 91
:.||
Rat 349 QNLS 352
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0383 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.