DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd3 and Aire

DIOPT Version :9

Sequence 1:NP_649111.1 Gene:Chd3 / 40111 FlyBaseID:FBgn0023395 Length:892 Species:Drosophila melanogaster
Sequence 2:XP_006256309.1 Gene:Aire / 294328 RGDID:1311139 Length:551 Species:Rattus norvegicus


Alignment Length:69 Identity:32/69 - (46%)
Similarity:43/69 - (62%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PKTNAKKQKFRDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRCIPLPGKAE 87
            |..|..:...::|:.|.||.|||:|:|||.||..:|..||||||:.||.|.|.|..|  |.|:.:
  Rat   286 PLPNEPQVHQKNEDECAVCHDGGELICCDGCPRAFHLACLSPPLQEIPSGLWRCSCC--LQGRIQ 348

  Fly    88 KILS 91
            :.||
  Rat   349 QNLS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd3NP_649111.1 PHD2_CHD_II 37..79 CDD:277007 24/41 (59%)
CHROMO 85..147 CDD:237991 2/7 (29%)
CHROMO 181..233 CDD:214605
SNF2_N 270..561 CDD:278600
DEXDc 288..440 CDD:238005
Helicase_C 585..700 CDD:278689
AireXP_006256309.1 Sp100 17..103 CDD:281203
SAND 198..264 CDD:295351
PHD1_AIRE 300..342 CDD:277014 24/41 (59%)
PHD2_AIRE 433..475 CDD:277015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0383
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.