DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd3 and Phf21b

DIOPT Version :9

Sequence 1:NP_649111.1 Gene:Chd3 / 40111 FlyBaseID:FBgn0023395 Length:892 Species:Drosophila melanogaster
Sequence 2:NP_001074635.2 Gene:Phf21b / 271305 MGIID:2443812 Length:487 Species:Mus musculus


Alignment Length:168 Identity:48/168 - (28%)
Similarity:67/168 - (39%) Gaps:56/168 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKRGADPDWKTPGKASKDKRPKTNAKKQKFRDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPP 65
            ::::...||.||  |:.:.|               |:|..|..|..|..|.:|...||.:||.||
Mouse   290 LTARANEDPCWK--GEITHD---------------EFCAACKRGASLQPCGTCSGAYHLSCLDPP 337

  Fly    66 LKSIPKGDWICPRCIPLPGKAEKILSWRWALDRSVELRTSKGEKRREYFIKWHGM-----SYWHC 125
            ||:.|||.|:||:|            .|.||             :::..:.|.||     ||...
Mouse   338 LKTPPKGLWVCPKC------------QRKAL-------------KKDEGVPWTGMLAIVHSYVTH 377

  Fly   126 EWI--PEGQMLLHHASMVASFQRRSDMEEPSLEELDDQ 161
            :.:  .|.|.||...|.:.|       |...|||.|.|
Mouse   378 KTVKEEEKQKLLQRGSELQS-------EHQQLEERDRQ 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd3NP_649111.1 PHD2_CHD_II 37..79 CDD:277007 20/41 (49%)
CHROMO 85..147 CDD:237991 14/68 (21%)
CHROMO 181..233 CDD:214605
SNF2_N 270..561 CDD:278600
DEXDc 288..440 CDD:238005
Helicase_C 585..700 CDD:278689
Phf21bNP_001074635.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..229
PHD_SF 309..351 CDD:304600 20/41 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0383
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.