Sequence 1: | NP_649111.1 | Gene: | Chd3 / 40111 | FlyBaseID: | FBgn0023395 | Length: | 892 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001355360.1 | Gene: | phf-32 / 184600 | WormBaseID: | WBGene00008902 | Length: | 208 | Species: | Caenorhabditis elegans |
Alignment Length: | 223 | Identity: | 56/223 - (25%) |
---|---|---|---|
Similarity: | 89/223 - (39%) | Gaps: | 55/223 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 DPDWKTPGKASKDKRPKTNAKKQKFRDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIP-- 70
Fly 71 -KGDWICPR---------CIPLPGKAEKILSWRWALDRSVELRTSKGEKRREYFIKWHGMSYWHC 125
Fly 126 EWIPEGQMLLHHASMVASFQRRSDMEEPSLEELDDQDGNLHERFYRYGIK-PEWLLVQRVINHSE 189
Fly 190 E----PNGG-----------TMYLVKWR 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Chd3 | NP_649111.1 | PHD2_CHD_II | 37..79 | CDD:277007 | 19/53 (36%) |
CHROMO | 85..147 | CDD:237991 | 12/61 (20%) | ||
CHROMO | 181..233 | CDD:214605 | 8/37 (22%) | ||
SNF2_N | 270..561 | CDD:278600 | |||
DEXDc | 288..440 | CDD:238005 | |||
Helicase_C | 585..700 | CDD:278689 | |||
phf-32 | NP_001355360.1 | PHD_SF | 32..71 | CDD:389947 | 16/40 (40%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0383 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |