DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Chd3 and Aire

DIOPT Version :9

Sequence 1:	NP_649111.1	Gene:	Chd3 / 40111	FlyBaseID:	FBgn0023395	Length:	892	Species:	Drosophila melanogaster
Sequence 2:	NP_033776.1	Gene:	Aire / 11634	MGIID:	1338803	Length:	552	Species:	Mus musculus

Alignment Length:	78	Identity:	35/78 - (44%)
Similarity:	45/78 - (57%)	Gaps:	7/78 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 PGKASKDKRPKTNAKKQKFRDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPR 78
            |...|....|:.|.|     :|:.|.||.|||:|:|||.||..:|..||||||:.||.|.|.|..
Mouse   282 PPLPSLPSEPQVNQK-----NEDECAVCHDGGELICCDGCPRAFHLACLSPPLQEIPSGLWRCSC 341

  Fly    79 CIPLPGKAEKILS 91
            |  |.|:.::.||
Mouse   342 C--LQGRVQQNLS 352

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Chd3	NP_649111.1	PHD2_CHD_II	37..79	CDD:277007	24/41 (59%)
		CHROMO	85..147	CDD:237991	2/7 (29%)
		CHROMO	181..233	CDD:214605
		SNF2_N	270..561	CDD:278600
		DEXDc	288..440	CDD:238005
		Helicase_C	585..700	CDD:278689
Aire	NP_033776.1	LXXLL motif 1	8..12
		Sp100	17..103	CDD:281203
		LXXLL motif 2	64..68
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	109..177
		Nuclear localization signal. /evidence=ECO:0000255	114..134
		SAND	198..264	CDD:128554
		PHD1_AIRE	300..342	CDD:277014	24/41 (59%)
		LXXLL motif 3	414..418
		PHD2_AIRE	433..475	CDD:277015
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	472..514
		LXXLL motif 4	520..524
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0383
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900