DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pip and usta

DIOPT Version :9

Sequence 1:NP_788536.1 Gene:pip / 40104 FlyBaseID:FBgn0003089 Length:514 Species:Drosophila melanogaster
Sequence 2:XP_009293006.1 Gene:usta / 557218 ZFINID:ZDB-GENE-041001-163 Length:411 Species:Danio rerio


Alignment Length:327 Identity:85/327 - (25%)
Similarity:153/327 - (46%) Gaps:57/327 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VFFNRVPKVGSQSLMELMARLGKINGFT------HARNKGSAHETIVMNKQRQNDLIADLLTRPK 275
            |.:|||.|.||::::.|:..|.:.:.|.      |.:.:.:.||.:    ....|||.::...|:
Zfish    98 VIYNRVGKCGSRTVVLLLRILAEKHQFNLVSSDIHNKTRLTKHEQV----SGWVDLITNISNIPQ 158

  Fly   276 PHIYSQHIAYINFTRFHLPKPIYINLIRDPIDRIISWHYYIRAPWYYRDMQAKLGENAIPMPSEE 340
            |.:|::|:.::|||||.:.:|:|||:|||||:|.:| :|:.|....:|..|..|...  |...::
Zfish   159 PFLYTRHVHFLNFTRFRIEQPVYINIIRDPINRFLS-NYFFRRFGDWRGEQNHLIRT--PQMKDD 220

  Fly   341 FMNLDLDTCVRNHDPHCTFTQMQIKNPVGDHRRQTLFFCGMNQKLCMPFNSEAAMQKAKRTVETE 405
            ...||::.|:..:.|.|:..::....|         :|||.:.:...|  ...|:::||:.|...
Zfish   221 ERYLDINVCIMENYPECSNPRLFYIVP---------YFCGQHPQCREP--GMWAVERAKQNVIEN 274

  Fly   406 YAVVGTWEDTNITLSVLEAYIPRYFRNAKVAY----YLGKDRLSRVNRNNVTRIVSDETRLILRK 466
            :.:||..|:....|.:||..:|.||.:....|    :.....|:...:.::..|   |...:|.:
Zfish   275 FLLVGILEELEDVLLLLERLLPHYFSDVLTIYKSPAFWKMGNLTGTVKKHMPTI---EALQVLYQ 336

  Fly   467 NLTNEIEFYEFCKQRLYLQYAALSHGKRFG----------EDDYL----------LVPEQQNEYN 511
            .:..|.:||.|.:.:.:|.      .|:.|          |.|:|          |..|::.|..
Zfish   337 RMKYEYDFYNFIRDQFHLT------KKKIGLKSSSQNSAHEPDFLRELALRTHEPLEEEEEEEEE 395

  Fly   512 ED 513
            ||
Zfish   396 ED 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pipNP_788536.1 Sulfotransfer_2 212..477 CDD:281554 73/269 (27%)
ustaXP_009293006.1 Sulfotransfer_2 97..>280 CDD:304664 57/199 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3922
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375927at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4474
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.