DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pip and Hs2st

DIOPT Version :9

Sequence 1:NP_788536.1 Gene:pip / 40104 FlyBaseID:FBgn0003089 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_477339.1 Gene:Hs2st / 44433 FlyBaseID:FBgn0024230 Length:349 Species:Drosophila melanogaster


Alignment Length:337 Identity:93/337 - (27%)
Similarity:150/337 - (44%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 EVHYEDDEDEVEENDDDLAND---VGTTDSEGFNFKADLLNNTKYAEVDFVFFNRVPKVGSQSLM 231
            |:..|.....:.:..|.|:.|   ..|||.  |:|:..|:          |.:|||||.||.|.:
  Fly    37 EIRLEHAFKPLSKLGDSLSPDQHASSTTDD--FDFEEHLV----------VLYNRVPKTGSTSFV 89

  Fly   232 ELMARLGKINGF--THARNKGSAHE-------TIVMNKQRQNDLIADLLTRPKPHIYSQHIAYIN 287
            .:...|.|.|.|  .|.....:.|.       ..|.|..|.:::        ||.:|..|:|:::
  Fly    90 NIAYDLCKPNKFHVLHINVTANMHVLSLPNQIQFVRNVSRWHEM--------KPALYHGHMAFLD 146

  Fly   288 FTRFHLP-KPIYINLIRDPIDRIISWHYYIRAPWYYRD--MQAKLGENAIPMPSEEFMNLDLDTC 349
            |::|.:. |||||||:|.|:||::|::|::|....||.  ::.|.|.           .:..|.|
  Fly   147 FSKFQIAHKPIYINLVRKPLDRLVSYYYFLRFGDNYRPNLVRKKAGN-----------KITFDEC 200

  Fly   350 VRNHDPHCTFTQMQIKNPVGDHRRQTLFFCGMNQKLCMPFNSEAAMQKAKRTVETEYAVVGTWED 414
            |....|.|....|.::.|         |||| :...|....|..|:.:|||.:..||.:||..|.
  Fly   201 VVQKQPDCDPKNMWLQIP---------FFCG-HAAECWEPGSSWALDQAKRNLVNEYFLVGVTEQ 255

  Fly   415 TNITLSVLEAYIPRYFRNAKVAYYLGKDRLSRVNRNNVTRIVSDETRLILRK----NLTNEI-EF 474
            ....:.:||..:||.|...:..|:.......||..:.:.  .|:.|...::|    .:.|:: :|
  Fly   256 MYEFVDLLERSLPRIFHGFREHYHNSNKSHLRVTSSKLP--PSESTIKSIQKTKIWQMENDLYDF 318

  Fly   475 ----YEFCKQRL 482
                :||.|::|
  Fly   319 ALAQFEFNKKKL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pipNP_788536.1 Sulfotransfer_2 212..477 CDD:281554 78/285 (27%)
Hs2stNP_477339.1 Sulfotransfer_2 70..325 CDD:281554 79/295 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3922
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3013
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375927at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.