DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pip and UST

DIOPT Version :9

Sequence 1:NP_788536.1 Gene:pip / 40104 FlyBaseID:FBgn0003089 Length:514 Species:Drosophila melanogaster
Sequence 2:NP_005706.1 Gene:UST / 10090 HGNCID:17223 Length:406 Species:Homo sapiens


Alignment Length:316 Identity:90/316 - (28%)
Similarity:157/316 - (49%) Gaps:47/316 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 FKADL---LNNTKYAE---------VDF---VFFNRVPKVGSQSLMELMARLGKINGFTHARNKG 250
            |..||   |.|:.|.:         :.|   |.:|||.|.||::::.|:..|.:.:||....:  
Human    74 FLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTS-- 136

  Fly   251 SAHETIVMNKQRQNDLIADLLTRPKPHIYSQHIAYINFTRFHLPKPIYINLIRDPIDRIISWHYY 315
            ..|....:.|..|.:||.::.|..:|:::::|:.::||:||...:|:|||:||||::|.:| :|:
Human   137 DIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFGGDQPVYINIIRDPVNRFLS-NYF 200

  Fly   316 IRAPWYYRDMQAKLGENAIPMPS--EEFMNLDLDTCVRNHDPHCTFTQMQIKNPVGDHRRQTLFF 378
            .|....:|..|    .:.|..||  :|...||::.|:..:.|.|:..::....|         :|
Human   201 FRRFGDWRGEQ----NHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIP---------YF 252

  Fly   379 CGMNQKLCMPFNSEAAMQKAKRTVETEYAVVGTWEDTNITLSVLEAYIPRYFRNAKVAYYLGKDR 443
            ||.:.:...|  .|.|:::||..|...:.:||..|:....|.:||.::|.||:.....|   ||.
Human   253 CGQHPRCREP--GEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPHYFKGVLSIY---KDP 312

  Fly   444 LSRVNRNNVT-----RIVSDETRLILRKNLTNEIEFYEFCKQRLYL---QYAALSH 491
            ..| ...|:|     .:.|.|...||.:.:..|.|||.:.|::.:|   ::...||
Human   313 EHR-KLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHYVKEQFHLLKRKFGLKSH 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pipNP_788536.1 Sulfotransfer_2 212..477 CDD:281554 80/283 (28%)
USTNP_005706.1 Sulfotransfer_2 104..356 CDD:328972 80/273 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3922
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375927at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4474
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.