DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gbs-76A and ppp1r3c2a

DIOPT Version :10

Sequence 1:NP_649104.1 Gene:Gbs-76A / 40102 FlyBaseID:FBgn0036862 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001353658.1 Gene:ppp1r3c2a / 336380 ZFINID:ZDB-GENE-030131-8324 Length:362 Species:Danio rerio


Alignment Length:203 Identity:61/203 - (30%)
Similarity:98/203 - (48%) Gaps:34/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 SLKTGKTPPGTPGRKKIVRFADVLGLDLADVKTFL---DEIPTIPKSAFEDLEILESEPPLQ--- 500
            ||.:..:...|..:||.|.|||..||:|..::.|:   .|:.|  :.|.:..|:::...|:|   
Zfish    60 SLSSYSSGTSTLRKKKQVVFADSKGLNLVSIRIFIADPSEMET--EEAAQSEELVKPRTPVQNLR 122

  Fly   501 ----LGPKSDKLLMPLFQQPGGLPKFLDAVREKQVSLENAAVTDNINQTISGSVRVRNLDFHKSV 561
                ||          |.||  :|. :.::.:..|.||:..|...:   :||:|||.||...|:|
Zfish   123 FKVKLG----------FSQP--VPD-IASLMKNFVQLESCRVKGRL---LSGTVRVFNLMLDKTV 171

  Fly   562 HIRYSLDGWRSYADLQA-NYVENSCDGFSDIFTFVLF-GNSLHVGQRLEFAVRFQCKG---QQFW 621
            .:|.:.|.|||:.|:.. |..|......:.:|.|:.: .:.|...:.|||.|.| |.|   :|:.
Zfish   172 FVRITYDSWRSHRDIPCINVREPHLSFQTALFEFMEYLPSDLDPKELLEFFVVF-CPGNVKKQYV 235

  Fly   622 DNNYGANY 629
            |:|.|..|
Zfish   236 DDNEGKQY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gbs-76ANP_649104.1 PRK02224 <208..>412 CDD:179385
PBD_PPP1R3 <434..475 CDD:455118 12/32 (38%)
CBM_21 527..629 CDD:427265 35/106 (33%)
ppp1r3c2aNP_001353658.1 PBD_PPP1R3 <72..>106 CDD:455118 12/35 (34%)
CBM_21 141..245 CDD:474061 36/107 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.