DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14089 and col-114

DIOPT Version :9

Sequence 1:NP_649103.1 Gene:CG14089 / 40101 FlyBaseID:FBgn0036861 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_501150.1 Gene:col-114 / 177500 WormBaseID:WBGene00000688 Length:321 Species:Caenorhabditis elegans


Alignment Length:165 Identity:61/165 - (36%)
Similarity:65/165 - (39%) Gaps:40/165 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VPRLITLQTGSPAPAPPQEVIIEEDHDHQHYHPPHYP--------PSYSYPYPQP---QPCGCPP 87
            ||...|:|....|.:||...:.          |...|        |....|..||   .|.| |.
 Worm   148 VPGKTTIQAPCEAASPPPCRVC----------PVGMPGEQGVTGAPGDKGPAGQPGRNGPDG-PN 201

  Fly    88 GPPGPPGPPGQPGQKGYPGPKGSKGD---------PGEKGPRGDKGHPGMPGIPGQPGPQGPPGY 143
            |.|||.|||||||..|.||..|..|.         ||:.||.||.|.||.||.||..||.|.||.
 Worm   202 GEPGPKGPPGQPGADGQPGMPGEPGKDAPQEGSPVPGDPGPPGDSGIPGPPGPPGMAGPDGIPGM 266

  Fly   144 PGGSYPPYPYPPP---------PPPPSHGHGGPKG 169
            .|......|..||         .||.|.|..|.||
 Worm   267 GGAKGQNGPDGPPGASGESGPNGPPGSGGGAGEKG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14089NP_649103.1 None
col-114NP_501150.1 Col_cuticle_N 15..66 CDD:198156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.