DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14089 and col-90

DIOPT Version :9

Sequence 1:NP_649103.1 Gene:CG14089 / 40101 FlyBaseID:FBgn0036861 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_498729.1 Gene:col-90 / 176117 WormBaseID:WBGene00000665 Length:305 Species:Caenorhabditis elegans


Alignment Length:242 Identity:65/242 - (26%)
Similarity:83/242 - (34%) Gaps:102/242 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VALLSVLGGVFA-----------KD-------------DASVPRLITLQTGSPAPAPPQEVIIEE 57
            :.||.||..:|:           :|             |.:..||:.||    :|....|.::  
 Worm    11 ICLLGVLSSLFSISHIVRDINSLRDEVEGRVDEFKVLADDTWQRLLVLQ----SPTGETENVM-- 69

  Fly    58 DHDHQHYHPPHYPPSYSYPYPQPQPC-----GCPPGPPGPPGPPGQPGQKGYPG----------- 106
                     |....|..:.||....|     |||.|||||||.||:.|.:|..|           
 Worm    70 ---------PSIFRSKRFVYPGMCNCDSNSQGCPAGPPGPPGLPGKRGDEGVVGDLGRSGASGIS 125

  Fly   107 --------------PKGSKGDPGEKGPRGDKGHPGMPGI------PGQPGP-------------- 137
                          |.|..|.||::||.|.:|.||:.|.      .|||||              
 Worm   126 LAAVHHIPGGCINCPAGPAGPPGQQGPVGPQGFPGVVGTCGPSGDDGQPGPAGPLGDKGAQGPKG 190

  Fly   138 ----QGPPGYPGGSYPP----YPYPP-----PPPPPSHGHGGPKGHQ 171
                .||.|.||.:|.|    .|..|     |..|..||..|..|.:
 Worm   191 FDGADGPDGMPGTAYFPGAVGQPGEPGWLGQPGLPGKHGEPGQDGEE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14089NP_649103.1 None
col-90NP_498729.1 Col_cuticle_N 3..55 CDD:198156 7/43 (16%)
Collagen 142..201 CDD:189968 19/58 (33%)
Collagen 208..267 CDD:189968 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.