DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14089 and rol-1

DIOPT Version :9

Sequence 1:NP_649103.1 Gene:CG14089 / 40101 FlyBaseID:FBgn0036861 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_496589.1 Gene:rol-1 / 174857 WormBaseID:WBGene00004394 Length:458 Species:Caenorhabditis elegans


Alignment Length:210 Identity:62/210 - (29%)
Similarity:71/210 - (33%) Gaps:82/210 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TGSPA--PAPPQEVIIEEDHDHQ-----------HYHPPHYPPSYSYP-------------YPQP 80
            |..|:  .|.|...:..|||:..           ...||..|.....|             .|..
 Worm   229 TSGPSGTTAAPTAEVTHEDHEESTATCDNCCLPGPAGPPGAPGRPGPPGKAGANGLPGNSGKPTK 293

  Fly    81 QPCG---------CPPGPPGPPGPPGQPGQKGYP------GPKGSKGDPGEKGPRGDKGHPGMPG 130
            :||.         ||.||.||.||.|..|..|.|      ||:|..|.||:||.||:||..|.||
 Worm   294 RPCNPVTKPPCVPCPQGPLGPAGPAGPQGNLGGPGVFGEKGPQGPVGAPGQKGRRGEKGKDGEPG 358

  Fly   131 IPGQP-----------------------GPQGPPGYPG----GSYPPYPYPP------------- 155
            .||.|                       ||:|.||.||    |.....|..|             
 Worm   359 APGAPGENVKEVPAIPGPQGTPGPRGRQGPRGAPGIPGKDGLGGDQGAPGEPGADGEPGMDGVPG 423

  Fly   156 -PPPPPSHGHGGPKG 169
             |....:|||||.||
 Worm   424 NPGRDGTHGHGGEKG 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14089NP_649103.1 None
rol-1NP_496589.1 Col_cuticle_N 12..64 CDD:198156
Collagen 308..366 CDD:189968 29/57 (51%)
Collagen 375..432 CDD:189968 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.