DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14089 and col-77

DIOPT Version :9

Sequence 1:NP_649103.1 Gene:CG14089 / 40101 FlyBaseID:FBgn0036861 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_495759.1 Gene:col-77 / 174336 WormBaseID:WBGene00000653 Length:304 Species:Caenorhabditis elegans


Alignment Length:131 Identity:49/131 - (37%)
Similarity:53/131 - (40%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QTGSPAPAPPQEVIIEEDHDHQHYHPPHYPPSYSYPYPQPQPCG---------CPPGPPGPPGPP 96
            |.|:|. ||..:             .|..||.......||.|.|         .|.||||||||.
 Worm   188 QAGAPG-APGND-------------GPQGPPGQDGAAGQPGPDGQPGVVEEVAVPAGPPGPPGPQ 238

  Fly    97 GQPGQKGYPGPKGSKGDPGEKGPRGDKGHPGMPGIPGQPGPQGPPGYPGGSYPPYPYPPPPPPPS 161
            |.||..|.||..|..|..|.:||.||.|..|.||..|..|.||..|.||........|||...|.
 Worm   239 GAPGTDGQPGSAGQPGQDGPQGPAGDAGTDGAPGQAGAAGEQGEAGQPGEGGGCDHCPPPRTAPG 303

  Fly   162 H 162
            :
 Worm   304 Y 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14089NP_649103.1 None
col-77NP_495759.1 Col_cuticle_N 18..70 CDD:198156
PRK07764 <155..302 CDD:236090 48/127 (38%)
Collagen 163..220 CDD:189968 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.