DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14089 and rol-8

DIOPT Version :9

Sequence 1:NP_649103.1 Gene:CG14089 / 40101 FlyBaseID:FBgn0036861 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_495582.1 Gene:rol-8 / 174226 WormBaseID:WBGene00004398 Length:329 Species:Caenorhabditis elegans


Alignment Length:126 Identity:53/126 - (42%)
Similarity:57/126 - (45%) Gaps:35/126 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PYPQPQPC-GCPPGPPGPPGPPGQPGQKGYPGPKGSKGDP------------GEKGPRGDKGHPG 127
            |.|..:|| .|   |.|.|||.|..|.||.||||||.|:|            |:.||.|..|..|
 Worm   176 PAPASEPCIIC---PTGAPGPMGAMGPKGPPGPKGSPGEPPQDGKSGDDGMAGQPGPIGRPGRDG 237

  Fly   128 MPGIPGQ-------PGPQGPPGYPGGSYPPYP----------YPPPPPPPSHGHGGPKGHQ 171
            |.|.||.       |||||.||.||...||.|          |..||.||  |..|..||:
 Worm   238 MKGAPGAAGRLIPVPGPQGAPGKPGPIGPPGPKGNPGPDGQSYQGPPGPP--GDSGTPGHE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14089NP_649103.1 None
rol-8NP_495582.1 Col_cuticle_N <30..66 CDD:279783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.