DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14089 and col-60

DIOPT Version :9

Sequence 1:	NP_649103.1	Gene:	CG14089 / 40101	FlyBaseID:	FBgn0036861	Length:	224	Species:	Drosophila melanogaster
Sequence 2:	NP_492013.1	Gene:	col-60 / 172445	WormBaseID:	WBGene00000636	Length:	302	Species:	Caenorhabditis elegans

Alignment Length:	132	Identity:	48/132 - (36%)
Similarity:	53/132 - (40%)	Gaps:	33/132 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    71 PSYSYPYPQP-QPCGCPPGPPGPPGPPGQPGQKGYPGPKGSKGDPGEKGPRGDKGHP-------- 126
            ||..|...|. ....||.||||..||.|.||:.|..|..||.|..|.:||.|.:|.|
Worm   125 PSEEYGNSQDGSTSTCPAGPPGEQGPDGAPGEAGRDGQPGSDGQSGNEGPTGPRGSPGNKGRDGN 189

  Fly   127 ------------------GMPGIPGQP---GPQGPPGYPGGSYPPYPY---PPPPPPPSHGHGGP 167
                              |.||.||||   ||:||.|.||....|..|   .|...|.:.|..||
Worm   190 PGRDGSPGRPGRDGTRGVGQPGSPGQPGSRGPEGPRGQPGNMGRPGEYGDAGPAGQPGNDGEQGP 254

  Fly   168 KG 169
            .|
Worm   255 DG 256

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14089	NP_649103.1	None
col-60	NP_492013.1	Col_cuticle_N	6..58	CDD:198156
		Collagen	143..200	CDD:189968	20/56 (36%)
		Collagen	208..267	CDD:189968	22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910