DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14086 and tmem72

DIOPT Version :9

Sequence 1:NP_649102.3 Gene:CG14086 / 40100 FlyBaseID:FBgn0036860 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001315015.1 Gene:tmem72 / 562321 ZFINID:ZDB-GENE-090313-175 Length:298 Species:Danio rerio


Alignment Length:147 Identity:34/147 - (23%)
Similarity:64/147 - (43%) Gaps:35/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CECLRPVIRVFGLLTSFVICGVGVDVYMHGYRAGL--YIVFSAVLVMFIEIKWLVTIFLQLQCAE 88
            |.|     ||.|:.|:.|:|.||::....|....|  |::.|::::|..|:.:.:...|      
Zfish    12 CSC-----RVLGISTAAVLCAVGIETQSQGEFTSLAVYLLLSSLVIMIFEVAYFIDALL------ 65

  Fly    89 DNYQRRSCSCLAC---------WRLSAICGGWRPTPVYAVIGICLILYPHNLWLSYVAGMFLILL 144
                   .:||.|         |:..|..||::....|.::.:...|:|..:|.:.:.|:.|::.
Zfish    66 -------ATCLPCPPTWKMFILWKKMAKVGGFQKFLYYTMMSVMCFLHPVLVWHAVIPGIMLVVT 123

  Fly   145 GLLRLCTLLRFSASKEE 161
            |      ...|..||::
Zfish   124 G------FFNFILSKKK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14086NP_649102.3 TMEM72 29..>138 CDD:292672 26/119 (22%)
tmem72NP_001315015.1 TMEM72 2..144 CDD:292672 34/147 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11629
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1128211at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28474
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.