DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14086 and Tmem72

DIOPT Version :9

Sequence 1:NP_649102.3 Gene:CG14086 / 40100 FlyBaseID:FBgn0036860 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001102113.1 Gene:Tmem72 / 362424 RGDID:1308850 Length:275 Species:Rattus norvegicus


Alignment Length:179 Identity:41/179 - (22%)
Similarity:73/179 - (40%) Gaps:26/179 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RVFGLLTSFVICGVGVDVYMHGYRAGL--YIVFSAVLVMFIEIKWLVTIFLQL--QCAEDNYQRR 94
            |:.|:.|:.|:.|||.:.::.|....|  |::|:.|.:...|..:.|...|.:  :|...:...|
  Rat    15 RLLGITTAAVLIGVGTETFLRGRFKSLAFYLLFTGVTISVCEGTYFVAQLLAICFKCQPGSLAHR 79

  Fly    95 SCSCLACWRLSAICGGWRPTPVYAVIGICLILYPHNLWLSYVAGMFLILLGLLRLCTLLRFSASK 159
            :.. .|.|     .|.::....|.::.:...|:|..:|...:.|..||:.||    .....|..|
  Rat    80 AKE-KAHW-----LGCFQKFLAYMLLSVACFLHPVLVWHVTIPGSMLIITGL----AYFLLSKRK 134

  Fly   160 EEGLLPQCDFEKVSSFVDTMEDDFAEIGATQAGLD-------EEAEEEG 201
            ::...|:     |....:...|..:.|.:|....|       .||.:||
  Rat   135 KKKAAPE-----VMPPTEQYRDPSSSIVSTTGSGDTEQTYTFHEAFKEG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14086NP_649102.3 TMEM72 29..>138 CDD:292672 24/107 (22%)
Tmem72NP_001102113.1 TMEM72 2..189 CDD:292672 41/179 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1128211at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28474
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.