Sequence 1: | NP_005160.2 | Gene: | PHOX2A / 401 | HGNCID: | 691 | Length: | 284 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097075.2 | Gene: | Drgx / 5740176 | FlyBaseID: | FBgn0085369 | Length: | 587 | Species: | Drosophila melanogaster |
Alignment Length: | 289 | Identity: | 101/289 - (34%) |
---|---|---|---|
Similarity: | 128/289 - (44%) | Gaps: | 94/289 - (32%) |
- Green bases have known domain annotations that are detailed below.
Human 40 PAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHE----KRKQRRIRTTFTSA 100
Human 101 QLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAASAKGAAGAAGAKK 165
Human 166 GEARCSSEDD---DSKESTCSPTPDSTA-------SLPP------PPAPG--------------- 199
Human 200 -----------------LASPRLSPSP--LPVALGSGPGPGPGPQ---------PLKGALWAGVA 236
Human 237 GGGGGGPGAGAAELLKAWQPAESGPGPFS 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PHOX2A | NP_005160.2 | Homeobox | 94..147 | CDD:365835 | 40/52 (77%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 145..284 | 44/180 (24%) | |||
Drgx | NP_001097075.2 | Homeobox | 56..108 | CDD:278475 | 40/51 (78%) |
OAR | 428..445 | CDD:281777 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |