Sequence 1: | NP_005160.2 | Gene: | PHOX2A / 401 | HGNCID: | 691 | Length: | 284 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_788420.1 | Gene: | hbn / 47894 | FlyBaseID: | FBgn0008636 | Length: | 409 | Species: | Drosophila melanogaster |
Alignment Length: | 273 | Identity: | 77/273 - (28%) |
---|---|---|---|
Similarity: | 97/273 - (35%) | Gaps: | 115/273 - (42%) |
- Green bases have known domain annotations that are detailed below.
Human 82 SGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFR 146
Human 147 KQER-------------------------------------------------------AASAKG 156
Human 157 -------------------------------------AAGAAGAKKG-EARCSSEDDDSKESTCS 183
Human 184 P-----TPDSTASLPPPPAPGLASPRLSPSPLPVALGSGPGPGPGPQPLKGALWAGVAGGGGGGP 243
Human 244 GAGAAELLKAWQP 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PHOX2A | NP_005160.2 | Homeobox | 94..147 | CDD:365835 | 36/52 (69%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 145..284 | 36/210 (17%) | |||
hbn | NP_788420.1 | Homeobox | 156..209 | CDD:278475 | 36/52 (69%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 127 | 1.000 | Inparanoid score | I4690 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.960 |