DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHOX2A and hbn

DIOPT Version :9

Sequence 1:NP_005160.2 Gene:PHOX2A / 401 HGNCID:691 Length:284 Species:Homo sapiens
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:273 Identity:77/273 - (28%)
Similarity:97/273 - (35%) Gaps:115/273 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    82 SGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFR 146
            |.:...||.||.|||||:.||.:|||.|.:|.|||::|||:||:::||:||||||||||||||:|
  Fly   145 SDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWR 209

Human   147 KQER-------------------------------------------------------AASAKG 156
            |:|:                                                       ||:|.|
  Fly   210 KREKFMNQDKAGYLLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAAAAG 274

Human   157 -------------------------------------AAGAAGAKKG-EARCSSEDDDSKESTCS 183
                                                 ||.||.|..| ....|.....|..|..|
  Fly   275 LLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGLSAMSQVS 339

Human   184 P-----TPDSTASLPPPPAPGLASPRLSPSPLPVALGSGPGPGPGPQPLKGALWAGVAGGGGGGP 243
            |     :|..:..|.|.|.|        |...|.|.|:|.|         |.|..|:.......|
  Fly   340 PPCSNSSPRESPKLVPHPTP--------PHATPPAGGNGGG---------GLLTGGLISTAAQSP 387

Human   244 GAGAAELLKAWQP 256
            .:.|.....|..|
  Fly   388 NSAAGASSNASTP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHOX2ANP_005160.2 Homeobox 94..147 CDD:365835 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..284 36/210 (17%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I4690
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.