DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG18754

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:242 Identity:59/242 - (24%)
Similarity:96/242 - (39%) Gaps:62/242 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PWTAILHHFGRIVGVGTLIHERFILTDVHCGDSIG--------VIRA-RLGE-----------YG 89
            ||..:|.:..|:    :||  |::||..||  .||        |::: ||||           ..
  Fly   118 PWMVLLLYENRL----SLI--RYVLTAAHC--VIGGYLTQNDLVLKSVRLGESTTDCITSESRCP 174

  Fly    90 RIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCI------LMDSRMQTF 148
            .:..|:.:..:...|.|:..    |..|::.|::|...|.|.:.|.|:|:      |.|..:|. 
  Fly   175 HLDVEVGQTTVHQGFTSSGG----TYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQI- 234

  Fly   149 ADELDYFNGTTWKNSDKSPMLRSKTV-IRMPQACGKLDH-------GQFCA-GHKDLDSCDEPSG 204
                     :.|..:..|..|.:.|| .|.|..|  |:.       .|.|| |.:..|:|...||
  Fly   235 ---------SGWDPTKSSQTLITSTVKERNPADC--LNRYPSFRSASQVCAGGQRKGDTCAGISG 288

  Fly   205 AALTREIDYIGPNRTVLFGIANSVEVKCSNS---RTYTDVVQLHQWI 248
            :.:...:.........|.|||:..:..|.::   ..||.:....:||
  Fly   289 SPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 59/242 (24%)
Tryp_SPc 42..248 CDD:214473 57/240 (24%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 59/242 (24%)
Tryp_SPc 108..335 CDD:214473 57/240 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.