DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG34171

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:237 Identity:45/237 - (18%)
Similarity:79/237 - (33%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HHFGRIVGVGTLIHERFILTDVHC-GDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPET 114
            :||    ..|.::..|.:||..|| .|..||:             ::...||.|..::....||:
  Fly    54 NHF----CTGVILTNRHVLTSAHCITDKNGVM-------------MSPKRIVVALCASLFKTPES 101

  Fly   115 -------------------QANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFAD---------- 150
                               |.|::.::||.|.|....|.:...:|.:|.::...|          
  Fly   102 EEFVVDIHNMIIHPYYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGV 166

  Fly   151 ---ELDYFNGTTWKNSDKSPMLRSKTVIRMPQACGKLDHGQFCAGHKDLDSCDEPSGAALTREID 212
               ....|:.....|.:..|......|.:...|....:....|....:...|....|..|..:  
  Fly   167 RRQRFGSFHSMLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFCD-- 229

  Fly   213 YIGPNRTVLFGIANSVEVKCSNSRT--YTDVVQLHQWISMVI 252
                  ..|:|||.. .:.||:...  ::||...:.|::.:|
  Fly   230 ------GQLYGIALG-SINCSSPDPVFFSDVSFYNSWVTKII 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 44/234 (19%)
Tryp_SPc 42..248 CDD:214473 43/231 (19%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 43/231 (19%)
Tryp_SPc 38..263 CDD:304450 44/234 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.