Sequence 1: | NP_649100.2 | Gene: | CG14088 / 40098 | FlyBaseID: | FBgn0036858 | Length: | 289 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097175.2 | Gene: | CG34171 / 5740474 | FlyBaseID: | FBgn0085200 | Length: | 292 | Species: | Drosophila melanogaster |
Alignment Length: | 237 | Identity: | 45/237 - (18%) |
---|---|---|---|
Similarity: | 79/237 - (33%) | Gaps: | 61/237 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 HHFGRIVGVGTLIHERFILTDVHC-GDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPET 114
Fly 115 -------------------QANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFAD---------- 150
Fly 151 ---ELDYFNGTTWKNSDKSPMLRSKTVIRMPQACGKLDHGQFCAGHKDLDSCDEPSGAALTREID 212
Fly 213 YIGPNRTVLFGIANSVEVKCSNSRT--YTDVVQLHQWISMVI 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14088 | NP_649100.2 | Tryp_SPc | 42..251 | CDD:304450 | 44/234 (19%) |
Tryp_SPc | 42..248 | CDD:214473 | 43/231 (19%) | ||
CG34171 | NP_001097175.2 | Trypsin | 29..260 | CDD:278516 | 43/231 (19%) |
Tryp_SPc | 38..263 | CDD:304450 | 44/234 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |