DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG9737

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:307 Identity:75/307 - (24%)
Similarity:115/307 - (37%) Gaps:97/307 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NICGERRDGLSPDIVG---------PWTAILHHFGRIVGV-GTLIHERFILTDVHC--GDSI--- 78
            |.||::   ::..|.|         ||.|:|.:.....|. |.||.:|.|||..||  |:.:   
  Fly   140 NECGKQ---VTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDR 201

  Fly    79 -GVIRARLGEYG---------------------RIGSELAEDHIVAAFFSNANFNPETQANNMGL 121
             |:...||||:.                     .|..|....|.....|||..:      |::.:
  Fly   202 QGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY------NDIAI 260

  Fly   122 MKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTWKNSD---------KSPMLRSKTVIRM 177
            ::|...|.:...::|:|:...|...|.| |...|:.:.|..:|         .||:   |..:|:
  Fly   261 IRLKHPVSFTHFVMPICLPNKSEPLTLA-EGQMFSVSGWGRTDLFNKYFINIHSPI---KLKLRI 321

  Fly   178 P----QACGKLDHG--------QFCAGHK-DLDSCDEPSGAALTREIDYIGP--------NRTVL 221
            |    :.|.|:..|        |.|||.: ..|:|...||          ||        :|.|.
  Fly   322 PYVSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSG----------GPLMYFDRQHSRWVA 376

  Fly   222 FGIANSVEVKC---SNSRTYTDVVQLHQWISMVIY----SSNTNDGM 261
            :|:.:....:|   .....||:|.:...||..|:.    |..|.|.|
  Fly   377 YGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQQRKKSQQTQDKM 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 67/278 (24%)
Tryp_SPc 42..248 CDD:214473 65/275 (24%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 65/276 (24%)
Tryp_SPc 150..409 CDD:238113 67/278 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.