DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:259 Identity:60/259 - (23%)
Similarity:94/259 - (36%) Gaps:76/259 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GNICGERRDGLSPDIVGP---------WTAILHHFGRIVGVGTLIHERFILTDVHCGDSIGVIRA 83
            ||:..|   |..|.|||.         |..           |::|...::||..||  :.|...|
  Fly    44 GNLASE---GQVPYIVGVSLNSNGNWWWCG-----------GSIIGHTWVLTAAHC--TAGADEA 92

  Fly    84 RLGEYGRIG-SELAEDHIVAAFFSNANFNPETQANNMGL---MKLLRTVVYKEHI---------- 134
            .| .||.:. :|.|..|.|    |:.||  ....:.:||   :.|::|    .|:          
  Fly    93 SL-YYGAVNYNEPAFRHTV----SSENF--IRYPHYVGLDHDLALIKT----PHVDFYSLVNKIE 146

  Fly   135 IPVCILMDSRMQTFADELDYFNGTTW-KNSDKSPMLRSKTVIRMPQACGKLDHGQFCAGHKDLDS 198
            :|   .:|.|..::  |.::.....| ...|.|.::....|:.:     |:.....|..:...|:
  Fly   147 LP---SLDDRYNSY--ENNWVQAAGWGAIYDGSNVVEDLRVVDL-----KVISVAECQAYYGTDT 201

  Fly   199 CDE-------PSGAALTREIDYIGPNRT----VLFGIANSVEV---KCSNSRTYTDVVQLHQWI 248
            ..|       |.|.| |.:.|..||..|    .|.||.:.|..   :......:|.|.:..:||
  Fly   202 ASENTICVETPDGKA-TCQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 55/245 (22%)
Tryp_SPc 42..248 CDD:214473 53/243 (22%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 58/257 (23%)
Tryp_SPc 41..266 CDD:238113 60/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.