DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG11843

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:227 Identity:60/227 - (26%)
Similarity:94/227 - (41%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GTLIHERFILTDVHCGDS----IGVIRARLGE--YGRIGSELA-EDHIVAAFFSNANFNPETQAN 117
            |.||.|||:||..||.:|    :.|:  ||||  :..:..:.| .|::||.:.::..:......:
  Fly   101 GVLISERFVLTAAHCLESERGEVNVV--RLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYH 163

  Fly   118 NMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADE--LDYFNGTTWKNS-----DKSPMLRSKTVI 175
            ::||:||...||:..:..|.|:       .|.||  .|.|....|.::     ..:.:|:.|...
  Fly   164 DIGLVKLTEAVVFDLYKHPACL-------PFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQR 221

  Fly   176 RMPQACGKL-------------DHGQFCAGHK-DLDSCDEPSGAALT---REIDYIGPNRTVLFG 223
            .....|.||             .:.|.|.|.: ..|:|:..||..|.   ||.    |...|:.|
  Fly   222 YGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREY----PCMYVVVG 282

  Fly   224 IANSVEVKCSN---SRTYTDVVQLHQWISMVI 252
            | .|..:.|.:   ...||.|.....||:..:
  Fly   283 I-TSAGLSCGSPGIPGIYTRVYPYLGWIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 60/224 (27%)
Tryp_SPc 42..248 CDD:214473 58/221 (26%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 60/224 (27%)
Tryp_SPc 68..309 CDD:214473 58/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.