DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG11842

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:256 Identity:64/256 - (25%)
Similarity:98/256 - (38%) Gaps:59/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SPDIVGPWTAILHHFGRIVGV--------------GTLIHERFILTDVHC----GDSIGVIRARL 85
            :|.|:|...|:...|.....:              ||||.:|.:||..||    ..|:.:  |||
  Fly    70 APLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNI--ARL 132

  Fly    86 G--EYGRIGSEL-AEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCI-LMDSRMQ 146
            |  |:.....:. .||..|..|.::..|:.....|::.:::|.|.|.:.::..|.|: ..|.|:.
  Fly   133 GDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLG 197

  Fly   147 TFADELDYFNGTTWKNSDKSPMLRSKTVIRMP-----QAC-------GKLDHG-----QFCAG-- 192
            |      .|....|...:..|...:|.:.::.     ..|       .:|..|     |.|.|  
  Fly   198 T------SFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSN 256

  Fly   193 -HKDLDSCDEPSGA-ALTREIDYIGPNRTVLFGIANSVEVKCSN---SRTYTDVVQLHQWI 248
             ||  |:|:..||. .|...:||  |....:.|| .|:.|.|..   ...||.|.....||
  Fly   257 EHK--DTCNGDSGGPVLIYHMDY--PCMYHVMGI-TSIGVACDTPDLPAMYTRVHFYLDWI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 63/253 (25%)
Tryp_SPc 42..248 CDD:214473 61/251 (24%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 63/253 (25%)
Tryp_SPc 73..312 CDD:214473 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.