DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG4815

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:290 Identity:60/290 - (20%)
Similarity:89/290 - (30%) Gaps:121/290 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTSLLIFLSGTGSAQFLGNICGERRDGLSPDIVGPWTAILHHFGRIV-----------GVG---- 60
            |..||:.|:...:.      .|.|.:         ||...|  .||.           |||    
  Fly     7 LVRLLLILNSVRTE------AGNREE---------WTGRFH--PRIYNGIKTTVESLGGVGIQLF 54

  Fly    61 ---------TLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPETQA 116
                     ||:..|.|||..||.:::.  |::.             |::..  .:|.|.  ...
  Fly    55 NGRKLVCSATLLTPRHILTAAHCFENLN--RSKF-------------HVIGG--KSAEFT--WHG 100

  Fly   117 NNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFAD-------------ELDY-------------- 154
            ||....||:|..::.::         ::|:..||             .:.|              
  Fly   101 NNFNKNKLIRVQIHPKY---------AKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKL 156

  Fly   155 ------FNGTTWKNSDKSPMLRSKTVIRMPQACGK-LDHGQ----FCAG-HKDLDSCDEPSGAAL 207
                  |.|..|..|.|......|..|...:.|.| ||...    .||| :.:...|...||..|
  Fly   157 IAAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPL 221

  Fly   208 T--REIDYIGPNRTVLFGIANSVEVKCSNS 235
            .  |::          .|| |:...||.|:
  Fly   222 LLGRQV----------CGI-NTWTFKCGNN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 54/259 (21%)
Tryp_SPc 42..248 CDD:214473 54/259 (21%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 48/231 (21%)
Trypsin 49..256 CDD:278516 48/231 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.