DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG10232

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:245 Identity:62/245 - (25%)
Similarity:95/245 - (38%) Gaps:51/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PWTAILHHFGRIVGV------GTLIHERFILTDVHC-------GDSIGVIRARLGEYG------- 89
            ||.|:|.:..|.:..      |:||::|::||..||       ...:.:.|.||||:.       
  Fly   269 PWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRVRLGEHDITTNPDC 333

  Fly    90 -----------RIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCILMDS 143
                       .||.|....|  ..:|:.:.|.     :::.|::|...|.|...|:|:|:..|.
  Fly   334 DFTGNCAAPFVEIGIEYFNVH--EQYFNTSRFE-----SDIALVRLQTPVRYTHEILPICVPKDP 391

  Fly   144 RMQTFADELDYFNGTTWKNSDKSPMLRSKTVIRMPQAC-GKL----DHGQFCA-GHKDLDSCDEP 202
             :......|........||.:.|.:|...||......| .|:    :..|.|| |.:..|||:..
  Fly   392 -IPLHNHPLQIAGWGYTKNREYSQVLLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGD 455

  Fly   203 SGA--ALTREIDYIGPNRTVLFGIANSVEVKCSNSR--TYTDVVQLHQWI 248
            ||.  .||...||  .:...|.||.:.....|.:.:  .||.......||
  Fly   456 SGGPLMLTLNNDY--QDIVYLAGIVSYGSENCGDRKPGVYTKTGAFFSWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 62/245 (25%)
Tryp_SPc 42..248 CDD:214473 60/243 (25%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 62/245 (25%)
Tryp_SPc 260..503 CDD:214473 60/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.