DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG16710

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:263 Identity:58/263 - (22%)
Similarity:99/263 - (37%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PWTAILHHFGRIVGV----------GTLIHERFILTDVHCGDSIG--VIRARLGEYGRIGS---- 93
            ||.|::.:..|...|          |:||..|::||..||....|  :.|.||||:..:.:    
  Fly   118 PWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVRLGEHNILSNPDCV 182

  Fly    94 -------ELAEDHI---VAAFFSNANFN--PETQANNMGLMKLLRTVVYKEHIIPVCILMD---- 142
                   ..|.:|:   |.....:.::.  .|...|::.|::|...|.|...|.|:|:.:|    
  Fly   183 THINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFS 247

  Fly   143 ----------------SRMQTFADEL--DYFNGTTWKNSDKSPMLRSKTVIRMPQACGKLDHGQF 189
                            |..|.:::.|  .|.||   :|:|:..:        ...:.|.......
  Fly   248 NPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNG---RNADECSL--------SEPSLGLDKETHI 301

  Fly   190 CAGH-KDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCS-NSRTYTDVVQLHQWISMVI 252
            |||: ...|:|...||..|...::........|.||.:....:|. ....||...:..:||...:
  Fly   302 CAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYGPAAYTKTSKFVEWILWNM 366

  Fly   253 YSS 255
            |::
  Fly   367 YTN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 57/257 (22%)
Tryp_SPc 42..248 CDD:214473 55/254 (22%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 55/254 (22%)
Tryp_SPc 106..362 CDD:238113 55/254 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.