DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG31219

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:289 Identity:67/289 - (23%)
Similarity:106/289 - (36%) Gaps:90/289 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ICGERRDGLSP-DIVG---------PWTAILHHFGRIV------GVGTLIHERFILTDVHCGDSI 78
            |||:   .||. .:||         ||.|:|.:.....      ..|:||:.|::||..||.:.|
  Fly    79 ICGQ---SLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGI 140

  Fly    79 ----GVIRARLGEYG---------------------RIGSELAEDHIVAAFFSNANFNPETQANN 118
                .:...||||:.                     .:..:|.:..:...|.|.:|.|.|   .:
  Fly   141 PRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIE---YD 202

  Fly   119 MGLMKLLRTVVYKEHIIPVCI-----LMDSRMQTFADELDYFNGTTWKNSDKSP--------MLR 170
            :.|::|...|.|:..|:|:||     ...|:::.          ..|..:::..        .:|
  Fly   203 IALLRLKMPVRYRTGIMPICIPKHGFFAKSKLEI----------AGWGKTNEGQFSQVLMHGFIR 257

  Fly   171 SKTV----IRMPQACGKLDHG---QFCAGHKD-LDSCDEPSGAALTREIDYIGPNRTV-LFGIAN 226
            .:::    :|.|.    ||..   |.|||..| :|:|...||..|...:|    |.:| |.||..
  Fly   258 ERSIAVCALRFPY----LDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMD----NSSVYLAGITT 314

  Fly   227 SVEVKCSN---SRTYTDVVQLHQWISMVI 252
            .....|..   ...||.......||..|:
  Fly   315 YGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 61/273 (22%)
Tryp_SPc 42..248 CDD:214473 59/270 (22%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 59/271 (22%)
Tryp_SPc 90..342 CDD:238113 61/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.