DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG4053

DIOPT Version :10

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:135 Identity:28/135 - (20%)
Similarity:59/135 - (43%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 YLHRELGFLNLPHGNLKSSNIFLAEDGEPLISEFGLQK--LINPDAQSQSLVAFKSPEADRDGTV 531
            |.||.....:..:|.:|.    :.:..|...||...::  ::..|.::..|:..:   ..:||  
  Fly     5 YAHRVAAVKDEENGAVKK----VTDSVENYNSENRFERTIIVANDNKTAILLILR---LKQDG-- 60

  Fly   532 SAKSDVFSFGVVVLEILTGKFPSQYAGLNRAGGANLVEWLGSALEQGGWMDLL-HPMVVTAAAED 595
             .|:.||:..:...||:.|:....:     ..||:.|....:.:.:....|:: |.:.|.|.||:
  Fly    61 -VKTSVFTNYLADDEIVLGEQKKAF-----VEGAHKVAVCTTQMFEKMEFDVVKHYIFVDAPAEE 119

  Fly   596 KIMEE 600
            |:.::
  Fly   120 KLRDQ 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..248 CDD:473915
CG4053NP_650601.2 Tryp_SPc 35..256 CDD:238113 20/101 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.