DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and snk

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:293 Identity:65/293 - (22%)
Similarity:104/293 - (35%) Gaps:74/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IFLSGTGSAQFLGNIC----------GERRDGLSPDIVG-PWTA--------ILHHFGRIVGVGT 61
            :.|:.||.. |.|..|          ...|.||.|.:.. .||.        |....|     |.
  Fly   165 LHLTDTGRT-FSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCG-----GA 223

  Fly    62 LIHERFILTDVHCGDSIGVIRARLGEYGRIG-------SELAEDHIVAAFFSNANFNPETQANNM 119
            |:.|.::||..||..|    .::..:..|:|       |...:|..:.....:..:......:::
  Fly   224 LVSELYVLTAAHCATS----GSKPPDMVRLGARQLNETSATQQDIKILIIVLHPKYRSSAYYHDI 284

  Fly   120 GLMKLLRTVVYKEHIIPVCI--LMDSRMQTFADELDYFNGTTWKNSD----KSPMLRSKTVIRMP 178
            .|:||.|.|.:.|.:.|.|:  |.:.::.|..       ...|..::    ||..||...:..:|
  Fly   285 ALLKLTRRVKFSEQVRPACLWQLPELQIPTVV-------AAGWGRTEFLGAKSNALRQVDLDVVP 342

  Fly   179 QACGK------------LDHGQFCAGH--KDLDSCDEPSGA---ALTREIDYIGPNRTVLFGIAN 226
            |...|            :..||||||:  ...|:|...||.   ||..|.:.:    ..:.|| .
  Fly   343 QMTCKQIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEYNCV----AFVVGI-T 402

  Fly   227 SVEVKCSNSR---TYTDVVQLHQWISMVIYSSN 256
            |....|:...   .||.:.....||..:.:..:
  Fly   403 SFGKFCAAPNAPGVYTRLYSYLDWIEKIAFKQH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 55/250 (22%)
Tryp_SPc 42..248 CDD:214473 53/247 (21%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 59/264 (22%)
Tryp_SPc 186..427 CDD:214473 57/261 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.