DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG13318

DIOPT Version :10

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:103 Identity:29/103 - (28%)
Similarity:50/103 - (48%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PWTAILHHFGRI-VGVGTLIHERFILTDVHCGDSIGV--IRARLGEYGRIGSE---LAEDHIVAA 103
            ||.|.|.....: :|.|.||..:.:||..|...::|:  .:.||||:....:.   .|:|..::.
  Fly   175 PWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISN 239

  Fly   104 FFSNANFNPETQANNMGLMKLLRTV--VYKEHIIPVCI 139
            .:.|.:|||....|::.::||...|  ..|..:..||:
  Fly   240 VYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..248 CDD:473915 29/103 (28%)
CG13318NP_649831.1 CLIP_1 <91..145 CDD:465709
Tryp_SPc 169..402 CDD:238113 29/103 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.