DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG13318

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:103 Identity:29/103 - (28%)
Similarity:50/103 - (48%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PWTAILHHFGRI-VGVGTLIHERFILTDVHCGDSIGV--IRARLGEYGRIGSE---LAEDHIVAA 103
            ||.|.|.....: :|.|.||..:.:||..|...::|:  .:.||||:....:.   .|:|..::.
  Fly   175 PWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISN 239

  Fly   104 FFSNANFNPETQANNMGLMKLLRTV--VYKEHIIPVCI 139
            .:.|.:|||....|::.::||...|  ..|..:..||:
  Fly   240 VYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 29/103 (28%)
Tryp_SPc 42..248 CDD:214473 29/103 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 29/103 (28%)
Tryp_SPc 169..399 CDD:214473 29/103 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.