DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG8329

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:268 Identity:53/268 - (19%)
Similarity:88/268 - (32%) Gaps:73/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FLGNICGER-------RDGLSPDIV----------GPWTAILHHFGRIVGVGTLIHERFILTDVH 73
            |:..:|..|       ..|...||:          .|:...|......||.|::|...::||..|
  Fly    11 FVATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAH 75

  Fly    74 C--GDSI----GVIRARLGEYGRIGSELAEDHIVAA--FFSNANFNPETQANNMGLMK---LLRT 127
            |  .||:    |..||..|:.         .|.|..  ||.:..: |.:..:::||::   :..|
  Fly    76 CLTTDSVTIHYGSNRAWNGQL---------QHTVNKNNFFRHPGY-PNSAGHDIGLIRTPYVSFT 130

  Fly   128 VVYKEHIIPVCILMDSRMQTF---------------ADELDYFNGTTWKNSDKSPMLRSKTVIRM 177
            .:..:..:|.......|.:.:               ||.|...:.....|.:   ..||...:..
  Fly   131 NLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGE---CARSYGSVAS 192

  Fly   178 PQACGKLDHGQ-FCAGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKC-SNSRTYTD 240
            ...|.:...|: .|.|        :..||.:|.:       ..:..|:.....:.| |....||.
  Fly   193 TDMCTRATDGKSVCGG--------DSGGALVTHD-------NPIQVGVITFASIGCKSGPSGYTR 242

  Fly   241 VVQLHQWI 248
            |.....||
  Fly   243 VSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 48/245 (20%)
Tryp_SPc 42..248 CDD:214473 46/243 (19%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 47/244 (19%)
Tryp_SPc 35..250 CDD:214473 45/242 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.