DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG3088

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:168 Identity:38/168 - (22%)
Similarity:55/168 - (32%) Gaps:69/168 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLIFLSGT----GSAQFLGNICGERRDGLSPDIV-----------GPWTAILHHFGRIVGV---- 59
            |::||..|    |||         ::|...||.:           .|:         :||:    
  Fly     4 LVVFLGLTLVAAGSA---------KKDSEDPDHIITNGSPAYEGQAPY---------VVGMAFGQ 50

  Fly    60 ------GTLIHERFILTDVHC--GDSIGV---------------IRARLGEYGRIGSELAEDHIV 101
                  ||:|.:.:|||...|  |.| ||               :.....||......||...:.
  Fly    51 SNIWCSGTIIGDTWILTSAQCLTGSS-GVTIYFGATRLSQAQFTVTVGTSEYVTGNQHLALVRVP 114

  Fly   102 AAFFSNANFNPETQANNMGLMKLL-RTVVYKEHIIPVC 138
            ...|||       :.|.:.|..|. |:..|:.....||
  Fly   115 RVGFSN-------RVNRVALPSLRNRSQRYENWWANVC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 28/136 (21%)
Tryp_SPc 42..248 CDD:214473 28/136 (21%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 28/134 (21%)
Tryp_SPc 29..244 CDD:214473 28/134 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.