DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG33465

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:258 Identity:73/258 - (28%)
Similarity:118/258 - (45%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GSAQFLGNICGERRDGLSPDI--------VGPWTAILHHFGRIVGVGTLIHERFILTDVHCGDSI 78
            |.||.|...|.:.:  .|.:|        ..||.|.::...:.:..|||:|:.|:||...|....
  Fly    17 GLAQLLDKKCHDPK--TSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVLTAASCISKD 79

  Fly    79 GVIRARLGEYG--RIGSEL--AEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCI 139
            ..:....|.|.  |..|:.  .|.:.||....::||.|....|::||::|...|.:..||.|:||
  Fly    80 SQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICI 144

  Fly   140 LMDSRMQTFADELDYFNGTTW--KNSDKSPMLRSKTVI--RMPQACGK------LDHGQFCAGHK 194
            ::|..::  :...:.|.|..|  :.::.|..:|....:  :.|..|.:      ::.||||||::
  Fly   145 ILDHVVK--SAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNR 207

  Fly   195 DLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQLHQWISMVIYSSNT 257
            |...|...||:.||.:..|...|.||..|:.:.....||.:..|||||....||...:.:..|
  Fly   208 DRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKDWIYNTVRNFET 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 66/230 (29%)
Tryp_SPc 42..248 CDD:214473 64/227 (28%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/219 (30%)
Tryp_SPc 46..261 CDD:214473 63/216 (29%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.