DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG10469

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:262 Identity:51/262 - (19%)
Similarity:106/262 - (40%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LEIVAVLTSLLIFLSGTGSAQFLGNICGERRD-----GL---------SPDIVGPWTAILHHFGR 55
            |::|.::...|:|...|||.:.:.....:.:.     ||         .|::.|           
  Fly     3 LQLVLIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCG----------- 56

  Fly    56 IVGVGTLIHERFILTDVHC-GDSIGVIRARLGEYGRIGSELAEDHIVAAFFS--NANFNPETQAN 117
                ||::..|:|:|..|| .|....:...|...|::.|...::.:|...::  :..|:.:|..|
  Fly    57 ----GTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTN 117

  Fly   118 NMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTWKNSDK-----------SPMLRS 171
            ::.|:||.:.:.:.::|.|.  .:.|..:|:.......:|  |..:.|           :|::.:
  Fly   118 DIALIKLPKKLTFNKYIQPA--KLPSAKKTYTGRKAIISG--WGLTTKQLPSQVLQYIRAPIISN 178

  Fly   172 KTVIRM--PQACGK----LDHGQFCAGHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEV 230
            |...|.  .|..||    :.:|..|...|....|...||..:..:    ..:||::..:::..:.
  Fly   179 KECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLD----DGSRTLVGIVSHGFDG 239

  Fly   231 KC 232
            :|
  Fly   240 EC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 41/211 (19%)
Tryp_SPc 42..248 CDD:214473 41/211 (19%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 44/242 (18%)
Tryp_SPc 24..260 CDD:238113 44/241 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.