DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:193 Identity:38/193 - (19%)
Similarity:68/193 - (35%) Gaps:60/193 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LEIVAVLTSLLIFLSGT-------------GSAQFLGNIC--GERRDGLSPDIV---------GP 45
            ::::|||. |.:..|.|             |.|...|.|.  ....:|..|.||         |.
  Fly     1 MKVLAVLL-LGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGT 64

  Fly    46 WTAILHHFGRIVGVGTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIV--AAFFSNA 108
            |..           |::|...:::|..||.|.:..:....|...|:.::..  |.|  :.|..:.
  Fly    65 WCG-----------GSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYT--HWVGRSDFIEHG 116

  Fly   109 NFNPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNG-----TTW-KNSDK 165
            :          |.:.|:||    .|:....::....:..:.|..:.:.|     :.| |.||:
  Fly   117 S----------GDISLIRT----PHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 26/141 (18%)
Tryp_SPc 42..248 CDD:214473 26/141 (18%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 29/156 (19%)
Tryp_SPc 41..257 CDD:238113 28/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.