DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:268 Identity:60/268 - (22%)
Similarity:96/268 - (35%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGNICGERRDGLSPDIVGPWTAILHHFGRIVGV-------------GTLIHERFILTDVHCGDSI 78
            :|:|.|.        |.|...|.:..|...||:             |:||...::||..||.|.:
  Fly    31 VGDIGGR--------ITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGV 87

  Fly    79 GVIRARLGEYGRIGSEL-----AEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVC 138
            ..:...||...|..:|:     :.|.|:.:.:::||..     |::.|:|:..|...........
  Fly    88 QSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLR-----NDISLIKIPATSSSSRISAVKL 147

  Fly   139 ILMDSRMQTFADELDYFNGTTW-KNSDKSPMLRSK------TVI---RMPQACGK--LDHGQFCA 191
            ..:.:...||..::...:|  | :.||.|..:.:.      |||   :..|..|.  :.....|.
  Fly   148 PSISNSYSTFVGDVAVASG--WGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCV 210

  Fly   192 GHKDLDS-CDEPSGA--ALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQLHQWISMVIY 253
            ...|..| |:..||.  .|....:.||   ...||.:...|.  .....:|.|.....||     
  Fly   211 ATTDAKSTCNGDSGGPLVLKSSSEQIG---LTSFGASAGCEK--GYPAAFTRVTSYLDWI----- 265

  Fly   254 SSNTNDGM 261
              .||.|:
  Fly   266 --KTNTGI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 54/241 (22%)
Tryp_SPc 42..248 CDD:214473 52/238 (22%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 52/247 (21%)
Tryp_SPc 38..268 CDD:238113 54/248 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.