DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG10477

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:289 Identity:67/289 - (23%)
Similarity:104/289 - (35%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLLIFLSGTGSAQFLGNICGERRD--------GLSPDIVGPWT----AILHHFGRIVGV------ 59
            ::|:....|.||..|      |:|        ...|.|.|..|    |..:.|...||:      
  Fly     5 AVLVLAIATVSADIL------RQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSA 63

  Fly    60 ------GTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAAFFSNANFNPETQANN 118
                  |::|...::||..||......:....|...|..::|.:....:.|..:|.:|..|..|:
  Fly    64 GSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRND 128

  Fly   119 MGLMK---LLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTW-KNSDKSPMLRSKTVIRMPQ 179
            :.|:|   :..||...:..:|.   :.|...|:|.:....:|  | :.||.|  :...|.::..|
  Fly   129 ISLIKTPSVTFTVSINKIALPA---IASSYSTYAGQTAVASG--WGRTSDSS--IAVATNLQYAQ 186

  Fly   180 -------ACGK------LDHGQFCAGHKDLDS-CDEPSGAALTREIDYIGPNRTVLFGIANSVEV 230
                   .|.|      :..|..|....:..| |...||..|...      ||  |.|:.:.|..
  Fly   187 FQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALN------NR--LIGVTSFVSS 243

  Fly   231 K-CSNSRT--YTDVVQLHQWI---SMVIY 253
            | |..:..  :|.|.....||   |.|.|
  Fly   244 KGCEKNAPAGFTRVTSYLDWIKNQSGVFY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 57/248 (23%)
Tryp_SPc 42..248 CDD:214473 54/242 (22%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 52/239 (22%)
Tryp_SPc 40..267 CDD:238113 54/241 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.