DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG12133

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:292 Identity:70/292 - (23%)
Similarity:107/292 - (36%) Gaps:91/292 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ICGERRDGLSPD---IVG---------PWTAILHHFGRI-------VGVGTLIHERFILTDVHC- 74
            :||:     ||.   |||         |||.:|.:....       :..|:||..|::||..|| 
  Fly    52 VCGQ-----SPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCL 111

  Fly    75 -GDSIGVIRARLGEYGRIGSELAEDHI----VAAFFSNANFN-------PETQ--------ANNM 119
             .:...|.|.||||:   .:|...|:.    .|..::.|:.:       |..|        .|::
  Fly   112 NVNDFYVARVRLGEH---DTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDI 173

  Fly   120 GLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTWKNS---DKSPMLRSKTVIRM-PQA 180
            .|::|...|.|...|.|:||.....:.|.:.:...|....|.:|   .||.:||..|:..| |..
  Fly   174 ALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDE 238

  Fly   181 CGKLDHGQFCAGHKDLDSC--------------DEPSGAALTREID---YI--------GPNRTV 220
            |  |:........||:..|              ..|..|::.|..|   |:        ||:.  
  Fly   239 C--LNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSS-- 299

  Fly   221 LFGIANSVEVKCSNSRTYTDVVQLHQWISMVI 252
             :|...:|         ||.....::||...|
  Fly   300 -YGYGPAV---------YTKTSSYYEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 65/274 (24%)
Tryp_SPc 42..248 CDD:214473 63/271 (23%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 65/274 (24%)
Tryp_SPc 62..317 CDD:214473 63/271 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.