DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and Jon44E

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:262 Identity:49/262 - (18%)
Similarity:78/262 - (29%) Gaps:105/262 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GLSPDIVGPWTAILHHFGRIVGVGTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIV 101
            |||.:..|.|..           |::|...::||..||.:|                   .:|::
  Fly    57 GLSFNDGGYWCG-----------GSIIDHTWVLTAAHCTNS-------------------ANHVL 91

  Fly   102 AAFFSNANFNPETQ--------------------ANNMGLMKLLRTVVYKEHIIPVCILMDSRMQ 146
            ..|  .|:|..|.|                    .|::.|:::       .|:....::....:.
  Fly    92 IYF--GASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRI-------PHVDFWSLVNKVELP 147

  Fly   147 TFADELDYFNG-----TTW----KNSDKSPMLRSKTV----------------IRMPQACGKLDH 186
            ::.|..:.::|     :.|    .||..|..|....|                |.....|...|.
  Fly   148 SYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDG 212

  Fly   187 GQFCAGHKDLDSCDEPSGAALTREIDYIGPNR---TVLFGIANSVEVKCSNSRT--YTDVVQLHQ 246
            |:        .||...||..|....:    ||   .|.||....    |:..|.  :|.|.....
  Fly   213 GK--------SSCSGDSGGPLVLHDN----NRIVGIVSFGSGEG----CTAGRPAGFTRVTGYLD 261

  Fly   247 WI 248
            ||
  Fly   262 WI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 46/257 (18%)
Tryp_SPc 42..248 CDD:214473 44/255 (17%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 47/260 (18%)
Tryp_SPc 41..266 CDD:238113 49/262 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.