DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and try-9

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:277 Identity:52/277 - (18%)
Similarity:82/277 - (29%) Gaps:120/277 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GTGSAQFLGNICGERRDGLSPDIVGPWTAILHHFGRIVGVGTLIHERFILTDVHCGDSIGVIRAR 84
            |:||.:..||...|..             .:.|     |.|||:....|:|..|.   ||:....
 Worm     8 GSGSFRNGGNKFSENE-------------FVQH-----GTGTLVSPWHIVTAAHL---IGISEDP 51

  Fly    85 LGEYGRIGSELAEDHIVAAF-----FSNAN---------------FNP----------------- 112
            |.:...  ..|.|.:.|..:     |.|..               |.|                 
 Worm    52 LPDCDT--GNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGC 114

  Fly   113 --ETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTWKNSDKSPMLR----- 170
              ....|::.:.:|...:.:.:.|.|.|:                     .::.|.|.:|     
 Worm   115 IDRESFNDIAVFELEEPIEFSKDIFPACL---------------------PSAPKIPRIRETGYK 158

  Fly   171 --------SKTVIRMPQACGKLDH---------------GQFC--AGHKDLDSCDEPSGAALTRE 210
                    |.:|:.    .|||..               |.:|  |.::.| |||..||:.:.|.
 Worm   159 LFGYGRDPSDSVLE----SGKLKSLYSFVAECSDDFPYGGVYCTSAVNRGL-SCDGDSGSGVVRT 218

  Fly   211 IDYIGPNRTVLFGIANS 227
            .|  ..|..||.|:.::
 Worm   219 SD--TRNVQVLVGVLSA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 46/255 (18%)
Tryp_SPc 42..248 CDD:214473 46/255 (18%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 44/237 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.