DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and scaf

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:268 Identity:61/268 - (22%)
Similarity:101/268 - (37%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGNICGERRDGLSPDIVG---------PWTA-ILHHFGR-IVGVGTLIHERFILTDVHCGDSIGV 80
            |..:|..|.....|..|.         ||.| ||....: ::..|.:|.::|:|:...|.:.:.|
  Fly   408 LAGVCATRNKRTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPV 472

  Fly    81 --IRARLGEYGRIGS-------ELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIP 136
              ||.:.||: .:||       :|..   |.....:.:::|.|.::::.:::|.|.:.:..||.|
  Fly   473 TDIRVKAGEW-ELGSTNEPLPFQLTG---VKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQP 533

  Fly   137 VCIL----MDSRMQTFADELD------YFNGTTWKNSDKSPMLRSKTVIRMPQACGKLDHGQFCA 191
            :||.    .||. |.|.....      :..|.....:|..|..||:        | ..|....|:
  Fly   534 ICISDEDPKDSE-QCFTSGWGKQALSIHEEGALMHVTDTLPQARSE--------C-SADSSSVCS 588

  Fly   192 GHKDLDSCDEPSGAALTREIDYIGPNRTVLFGIANSVEVK--------CSNSRTYTDVVQLHQWI 248
            ..| .|||....|:||.             .|..:||.:|        |...:|........:||
  Fly   589 ATK-FDSCQFDVGSALA-------------CGSGSSVRLKGIFAGENSCGEGQTVRFAKPDIKWI 639

  Fly   249 SMVIYSSN 256
            :.....:|
  Fly   640 NTAFAENN 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 56/246 (23%)
Tryp_SPc 42..248 CDD:214473 54/243 (22%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 51/215 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.