DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and CG4650

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:300 Identity:86/300 - (28%)
Similarity:149/300 - (49%) Gaps:31/300 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVAVLTSLLIFLSGTGSAQFLGNICGERRDG-LSPDIVGPWTAILHHFGRI-VGVGTLIHERFIL 69
            :|..:::||..|...||:|:|...||...:| ::.:|..||.|.||....: |..||:|.|:.:|
  Fly     4 VVIGISALLFLLPVPGSSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVL 68

  Fly    70 TDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAAF-----FSNANFNPETQANNMGLMKLLRTVV 129
            |..||..:...:.||:||:  ||::.|.|.:::.:     |.::.:|..|.||::.::.|...:|
  Fly    69 TAAHCTRASEQLVARIGEF--IGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIV 131

  Fly   130 YKEHIIPVCILMDSRMQTFADELDYFNGTTW---KNSDKSPMLRSKTVIRMP-QACGKLD----- 185
            :.:.|.|:||:..:..:.:.|.:...:|..|   .:.::|...|...:.|.| ..|..|:     
  Fly   132 FSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAIL 196

  Fly   186 HGQFCAGHKDLDSCD----EPSGAALTREIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQLHQ 246
            ..|||||..|...|:    .|.||.:|    :....|.||.|||.:.: ||..:..||||:. |.
  Fly   197 SSQFCAGDSDSKLCNVDFSSPLGAIIT----FKNIQRYVLIGIATTNQ-KCKRASVYTDVLS-HT 255

  Fly   247 WISMVIYSSNTNDGMDKPHNTTHLPEPVFELKSTSFSTNS 286
            ...:.::....|.  :|...|..| :..|::::|:...||
  Fly   256 DFILSVWRQYRNG--EKSPKTWDL-QNNFDVENTTLKANS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 67/227 (30%)
Tryp_SPc 42..248 CDD:214473 67/224 (30%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 68/232 (29%)
Tryp_SPc 33..258 CDD:304450 68/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.