DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14088 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:210 Identity:42/210 - (20%)
Similarity:69/210 - (32%) Gaps:57/210 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GTLIHERFILTDVHCGDSIGVIRARLGEYGRIGSELAEDHIVAA--FFSNANFNPETQANNMGLM 122
            |::|...::||..||.:....:....|...|..::..  |.|.:  |..|.|: |....|::.  
  Fly    66 GSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFT--HTVGSGDFIQNHNW-PNQNGNDIA-- 125

  Fly   123 KLLRTVVYKEHIIPVCILMDSRMQTFADELDYFN---------GTTWKNSDKSPMLRSKTVIRMP 178
             |:||    .|:....::....:.:|.|..:.::         |.|...|....|......|...
  Fly   126 -LIRT----PHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQPDWMECVDLQIISN 185

  Fly   179 QAC----GKLDHGQFC---AGHKDLDSCDE----------------------------PSG-AAL 207
            ..|    |....|..|   :|.|...|.|.                            ||| ..:
  Fly   186 SECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGLPSGFTRV 250

  Fly   208 TREIDYIGPNRTVLF 222
            |.::|:|..|..|.:
  Fly   251 TNQLDWIRDNSGVAY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 42/210 (20%)
Tryp_SPc 42..248 CDD:214473 42/210 (20%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 39/200 (20%)
Tryp_SPc 37..260 CDD:238113 40/203 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.